Lineage for d1syib1 (1syi B:1-258)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 710786Protein Glutamate receptor ligand binding core [53881] (4 species)
  7. 710787Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (53 PDB entries)
  8. 710887Domain d1syib1: 1syi B:1-258 [119079]
    automatically matched to d1m5da_
    complexed with cpw; mutant

Details for d1syib1

PDB Entry: 1syi (more details), 2.1 Å

PDB Description: x-ray structure of the y702f mutant of the glur2 ligand-binding core (s1s2j) in complex with (s)-cpw399 at 2.1 a resolution.
PDB Compounds: (B:) Glutamate receptor 2

SCOP Domain Sequences for d1syib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syib1 c.94.1.1 (B:1-258) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyafllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

SCOP Domain Coordinates for d1syib1:

Click to download the PDB-style file with coordinates for d1syib1.
(The format of our PDB-style files is described here.)

Timeline for d1syib1: