SCOP 1.73: Domain d1syia1: 1syi A:1-258

Lineage for d1syia1 (1syi A:1-258)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (4 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (53 PDB entries)

8. Domain d1syia1: 1syi A:1-258 [119078]
   automatically matched to d1m5da_
   complexed with cpw; mutant

Details for d1syia1

PDB Entry: 1syi, 2.1 Å

PDB Description: x-ray structure of the y702f mutant of the glur2 ligand-binding core (s1s2j) in complex with (s)-cpw399 at 2.1 a resolution.

PDB Compounds: (A:) Glutamate receptor 2

SCOP Domain Sequences for d1syia1:

Sequence; same for both SEQRES and ATOM records:

>d1syia1 c.94.1.1 (A:1-258) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyafllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

Timeline for d1syia1:

• d1syia1 is new in SCOP 1.73
  
• d1syia1 appears in SCOP 1.75
  
• d1syia1 appears in the current release, SCOPe 2.08, called d1syia_