![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.1: GroES [50130] (2 proteins) |
![]() | Protein Chaperonin-10 (GroES) [50131] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [50132] (7 PDB entries) |
![]() | Domain d1sx4t1: 1sx4 T:1-97 [119075] automatically matched to d1aono_ complexed with adp, mg |
PDB Entry: 1sx4 (more details), 3 Å
SCOPe Domain Sequences for d1sx4t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sx4t1 b.35.1.1 (T:1-97) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} mnirplhdrvivkrkevetksaggivltgsaaakstrgevlavgngrilengevkpldvk vgdivifndgygvksekidneevlimsesdilaivea
Timeline for d1sx4t1: