Class b: All beta proteins [48724] (180 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) |
Family b.35.1.1: GroES [50130] (2 proteins) automatically mapped to Pfam PF00166 |
Protein Chaperonin-10 (GroES) [50131] (4 species) |
Species Escherichia coli [TaxId:562] [50132] (7 PDB entries) |
Domain d1svtu_: 1svt U: [119069] Other proteins in same PDB: d1svta1, d1svta2, d1svta3, d1svtb1, d1svtb2, d1svtb3, d1svtc1, d1svtc2, d1svtc3, d1svtd1, d1svtd2, d1svtd3, d1svte1, d1svte2, d1svte3, d1svtf1, d1svtf2, d1svtf3, d1svtg1, d1svtg2, d1svtg3, d1svth1, d1svth2, d1svth3, d1svti1, d1svti2, d1svti3, d1svtj1, d1svtj2, d1svtj3, d1svtk1, d1svtk2, d1svtk3, d1svtl1, d1svtl2, d1svtl3, d1svtm1, d1svtm2, d1svtm3, d1svtn1, d1svtn2, d1svtn3 automated match to d1aono_ complexed with adp, af3, k, mg |
PDB Entry: 1svt (more details), 2.81 Å
SCOPe Domain Sequences for d1svtu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svtu_ b.35.1.1 (U:) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} mnirplhdrvivkrkevetksaggivltgsaaakstrgevlavgngrilengevkpldvk vgdivifndgygvksekidneevlimsesdilaivea
Timeline for d1svtu_:
View in 3D Domains from other chains: (mouse over for more information) d1svta1, d1svta2, d1svta3, d1svtb1, d1svtb2, d1svtb3, d1svtc1, d1svtc2, d1svtc3, d1svtd1, d1svtd2, d1svtd3, d1svte1, d1svte2, d1svte3, d1svtf1, d1svtf2, d1svtf3, d1svtg1, d1svtg2, d1svtg3, d1svth1, d1svth2, d1svth3, d1svti1, d1svti2, d1svti3, d1svtj1, d1svtj2, d1svtj3, d1svtk1, d1svtk2, d1svtk3, d1svtl1, d1svtl2, d1svtl3, d1svtm1, d1svtm2, d1svtm3, d1svtn1, d1svtn2, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_ |