SCOPe 2.08: Domain d1svda2: 1svd A:16-142

Lineage for d1svda2 (1svd A:16-142)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)

7. Species Halothiobacillus neapolitanus [TaxId:927] [143362] (1 PDB entry)
   Uniprot O85040 16-142

8. Domain d1svda2: 1svd A:16-142 [119058]
   Other proteins in same PDB: d1svda1, d1svdm1
   complexed with gol, so4

Details for d1svda2

PDB Entry: 1svd, 1.8 Å

PDB Description: The structure of Halothiobacillus neapolitanus RuBisCo

PDB Compounds: (A:) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit

SCOPe Domain Sequences for d1svda2:

Sequence; same for both SEQRES and ATOM records:

>d1svda2 d.58.9.1 (A:16-142) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Halothiobacillus neapolitanus [TaxId: 927]}
tywmpeytpldsdilacfkitpqpgvdreeaaaavaaesstgtwttvwtdlltdmdyykg
rayriedvpgddaafyafiaypidlfeegsvvnvftslvgnvfgfkavrglrledvrfpl
ayvktcg

Timeline for d1svda2:

• d1svda2 first appeared in SCOP 1.73
  
• d1svda2 appears in SCOPe 2.07