Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) |
Species Halothiobacillus neapolitanus [TaxId:927] [143362] (1 PDB entry) Uniprot O85040 16-142 |
Domain d1svda2: 1svd A:16-142 [119058] Other proteins in same PDB: d1svda1, d1svdm1 complexed with gol, so4 |
PDB Entry: 1svd (more details), 1.8 Å
SCOPe Domain Sequences for d1svda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svda2 d.58.9.1 (A:16-142) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Halothiobacillus neapolitanus [TaxId: 927]} tywmpeytpldsdilacfkitpqpgvdreeaaaavaaesstgtwttvwtdlltdmdyykg rayriedvpgddaafyafiaypidlfeegsvvnvftslvgnvfgfkavrglrledvrfpl ayvktcg
Timeline for d1svda2: