SCOPe 2.05: Domain d1susd_: 1sus D:

Lineage for d1susd_ (1sus D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.1: COMT-like [53336] (4 proteins)

6. Protein Caffeoyl-CoA O-methyltransferase [142573] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [142574] (2 PDB entries)
   Uniprot Q40313 21-247

8. Domain d1susd_: 1sus D: [119056]
   automated match to d1suia1
   complexed with ca, sah, spf

Details for d1susd_

PDB Entry: 1sus, 2.7 Å

PDB Description: crystal structure of alfalfa feruoyl coenzyme a 3-o-methyltransferase

PDB Compounds: (D:) Caffeoyl-CoA O-methyltransferase

SCOPe Domain Sequences for d1susd_:

Sequence; same for both SEQRES and ATOM records:

>d1susd_ c.66.1.1 (D:) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
ksllqsdalyqyiletsvfpreheamkelrevtakhpwnimttsadegqflsmllklina
kntmeigvytgysllatalaipedgkilamdinkenyelglpvikkagvdhkidfregpa
lpvldemikdeknhgsydfifvdadkdnylnyhkrlidlvkvggvigydntlwngsvvap
pdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgiticrrik

Timeline for d1susd_:

• d1susd_ first appeared in SCOP 1.73, called d1susd1
  
• d1susd_ appears in SCOPe 2.04
  
• d1susd_ appears in SCOPe 2.06
  
• d1susd_ appears in the current release, SCOPe 2.08