Lineage for d1susd_ (1sus D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892671Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2892672Protein Caffeoyl-CoA O-methyltransferase [142573] (1 species)
  7. 2892673Species Alfalfa (Medicago sativa) [TaxId:3879] [142574] (2 PDB entries)
    Uniprot Q40313 21-247
  8. 2892677Domain d1susd_: 1sus D: [119056]
    automated match to d1suia1
    complexed with ca, sah, spf

Details for d1susd_

PDB Entry: 1sus (more details), 2.7 Å

PDB Description: crystal structure of alfalfa feruoyl coenzyme a 3-o-methyltransferase
PDB Compounds: (D:) Caffeoyl-CoA O-methyltransferase

SCOPe Domain Sequences for d1susd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1susd_ c.66.1.1 (D:) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
ksllqsdalyqyiletsvfpreheamkelrevtakhpwnimttsadegqflsmllklina
kntmeigvytgysllatalaipedgkilamdinkenyelglpvikkagvdhkidfregpa
lpvldemikdeknhgsydfifvdadkdnylnyhkrlidlvkvggvigydntlwngsvvap
pdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgiticrrik

SCOPe Domain Coordinates for d1susd_:

Click to download the PDB-style file with coordinates for d1susd_.
(The format of our PDB-style files is described here.)

Timeline for d1susd_: