SCOP 1.73: Domain d1susc1: 1sus C:21-247

Lineage for d1susc1 (1sus C:21-247)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.1: COMT-like [53336] (3 proteins)

6. Protein Caffeoyl-CoA O-methyltransferase [142573] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [142574] (2 PDB entries)

8. Domain d1susc1: 1sus C:21-247 [119055]
   automatically matched to 1SUI A:21-247
   complexed with ca, sah, spf

Details for d1susc1

PDB Entry: 1sus, 2.7 Å

PDB Description: crystal structure of alfalfa feruoyl coenzyme a 3-o-methyltransferase

PDB Compounds: (C:) Caffeoyl-CoA O-methyltransferase

SCOP Domain Sequences for d1susc1:

Sequence; same for both SEQRES and ATOM records:

>d1susc1 c.66.1.1 (C:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
ksllqsdalyqyiletsvfpreheamkelrevtakhpwnimttsadegqflsmllklina
kntmeigvytgysllatalaipedgkilamdinkenyelglpvikkagvdhkidfregpa
lpvldemikdeknhgsydfifvdadkdnylnyhkrlidlvkvggvigydntlwngsvvap
pdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgiticrrik

Timeline for d1susc1:

• d1susc1 is new in SCOP 1.73
  
• d1susc1 appears in SCOP 1.75
  
• d1susc1 appears in the current release, SCOPe 2.08, called d1susc_