SCOPe 2.02: Domain d1ssha_: 1ssh A:

Lineage for d1ssha_ (1ssh A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186765] (3 PDB entries)

8. Domain d1ssha_: 1ssh A: [119048]
   automated match to d1oota_

Details for d1ssha_

PDB Entry: 1ssh, 1.4 Å

PDB Description: crystal structure of the sh3 domain from a s. cerevisiae hypothetical 40.4 kda protein in complex with a peptide

PDB Compounds: (A:) Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region

SCOPe Domain Sequences for d1ssha_:

Sequence; same for both SEQRES and ATOM records:

>d1ssha_ b.34.2.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsspkavalysfageesgdlpfrkgdvitilkksdsqndwwtgrvngregifpanyvelv

Timeline for d1ssha_:

• d1ssha_ first appeared in SCOP 1.73, called d1ssha1
  
• d1ssha_ appears in SCOPe 2.01
  
• d1ssha_ appears in SCOPe 2.03
  
• d1ssha_ appears in the current release, SCOPe 2.08, called d1ssha2