Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (38 proteins) |
Protein Hypothetical protein YFR024c [101679] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101680] (2 PDB entries) |
Domain d1ssha1: 1ssh A:3-60 [119048] automatically matched to d1oota_ |
PDB Entry: 1ssh (more details), 1.4 Å
SCOP Domain Sequences for d1ssha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ssha1 b.34.2.1 (A:3-60) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spkavalysfageesgdlpfrkgdvitilkksdsqndwwtgrvngregifpanyvelv
Timeline for d1ssha1: