Lineage for d1ssha1 (1ssh A:3-60)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665103Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 665104Family b.34.2.1: SH3-domain [50045] (38 proteins)
  6. 665291Protein Hypothetical protein YFR024c [101679] (1 species)
  7. 665292Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101680] (2 PDB entries)
  8. 665294Domain d1ssha1: 1ssh A:3-60 [119048]
    automatically matched to d1oota_

Details for d1ssha1

PDB Entry: 1ssh (more details), 1.4 Å

PDB Description: crystal structure of the sh3 domain from a s. cerevisiae hypothetical 40.4 kda protein in complex with a peptide
PDB Compounds: (A:) Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region

SCOP Domain Sequences for d1ssha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssha1 b.34.2.1 (A:3-60) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spkavalysfageesgdlpfrkgdvitilkksdsqndwwtgrvngregifpanyvelv

SCOP Domain Coordinates for d1ssha1:

Click to download the PDB-style file with coordinates for d1ssha1.
(The format of our PDB-style files is described here.)

Timeline for d1ssha1: