Lineage for d1ssha2 (1ssh A:2-60)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783255Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186765] (4 PDB entries)
  8. 2783256Domain d1ssha2: 1ssh A:2-60 [119048]
    Other proteins in same PDB: d1ssha3
    automated match to d1oota_

Details for d1ssha2

PDB Entry: 1ssh (more details), 1.4 Å

PDB Description: crystal structure of the sh3 domain from a s. cerevisiae hypothetical 40.4 kda protein in complex with a peptide
PDB Compounds: (A:) Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region

SCOPe Domain Sequences for d1ssha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssha2 b.34.2.1 (A:2-60) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sspkavalysfageesgdlpfrkgdvitilkksdsqndwwtgrvngregifpanyvelv

SCOPe Domain Coordinates for d1ssha2:

Click to download the PDB-style file with coordinates for d1ssha2.
(The format of our PDB-style files is described here.)

Timeline for d1ssha2: