![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein automated matches [190043] (8 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186765] (4 PDB entries) |
![]() | Domain d1ssha2: 1ssh A:2-60 [119048] Other proteins in same PDB: d1ssha3 automated match to d1oota_ |
PDB Entry: 1ssh (more details), 1.4 Å
SCOPe Domain Sequences for d1ssha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ssha2 b.34.2.1 (A:2-60) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sspkavalysfageesgdlpfrkgdvitilkksdsqndwwtgrvngregifpanyvelv
Timeline for d1ssha2: