Lineage for d1sqxh_ (1sqx H:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633065Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2633066Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 2633067Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 2633101Protein automated matches [190042] (4 species)
    not a true protein
  7. 2633119Species Cow (Bos taurus) [TaxId:9913] [186764] (7 PDB entries)
  8. 2633123Domain d1sqxh_: 1sqx H: [119045]
    Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxf_, d1sqxg_, d1sqxi_, d1sqxj_, d1sqxk_
    automated match to d1l0lh_
    complexed with fes, hem, sma, uq2

Details for d1sqxh_

PDB Entry: 1sqx (more details), 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a
PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOPe Domain Sequences for d1sqxh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqxh_ f.28.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
klfnslk

SCOPe Domain Coordinates for d1sqxh_:

Click to download the PDB-style file with coordinates for d1sqxh_.
(The format of our PDB-style files is described here.)

Timeline for d1sqxh_: