Lineage for d1sqxg1 (1sqx G:1-75)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887523Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
  5. 887524Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)
  6. 887525Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 887541Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries)
    Uniprot P13271 #SP
    Uniprot P13271
    Uniprot P13271 #SP ! Uniprot P13271
  8. 887552Domain d1sqxg1: 1sqx G:1-75 [119044]
    Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxf1, d1sqxh1, d1sqxi1, d1sqxj1, d1sqxk1
    automatically matched to d1be3g_
    complexed with fes, hem, sma, uq2

Details for d1sqxg1

PDB Entry: 1sqx (more details), 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a
PDB Compounds: (G:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOP Domain Sequences for d1sqxg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqxg1 f.23.13.1 (G:1-75) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

SCOP Domain Coordinates for d1sqxg1:

Click to download the PDB-style file with coordinates for d1sqxg1.
(The format of our PDB-style files is described here.)

Timeline for d1sqxg1: