Lineage for d1sqxf_ (1sqx F:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632997Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2632998Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 2632999Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 2633029Protein automated matches [190325] (4 species)
    not a true protein
  7. 2633059Species Cow (Bos taurus) [TaxId:9913] [192447] (4 PDB entries)
  8. 2633063Domain d1sqxf_: 1sqx F: [119043]
    Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxg_, d1sqxh_, d1sqxi_, d1sqxj_, d1sqxk_
    automated match to d1qcrf_
    complexed with fes, hem, sma, uq2

Details for d1sqxf_

PDB Entry: 1sqx (more details), 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a
PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOPe Domain Sequences for d1sqxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqxf_ f.27.1.1 (F:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

SCOPe Domain Coordinates for d1sqxf_:

Click to download the PDB-style file with coordinates for d1sqxf_.
(The format of our PDB-style files is described here.)

Timeline for d1sqxf_: