![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
![]() | Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) ![]() |
![]() | Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81643] (19 PDB entries) Uniprot P00157 |
![]() | Domain d1sqxc1: 1sqx C:261-379 [119039] Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxf_, d1sqxg_, d1sqxh_, d1sqxi_, d1sqxj_, d1sqxk_ automated match to d1ntmc1 complexed with fes, hem, sma, uq2 |
PDB Entry: 1sqx (more details), 2.6 Å
SCOPe Domain Sequences for d1sqxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqxc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]} plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw
Timeline for d1sqxc1: