SCOPe 2.07: Domain d1sqxc1: 1sqx C:261-379

Lineage for d1sqxc1 (1sqx C:261-379)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81643] (19 PDB entries)
   Uniprot P00157

8. Domain d1sqxc1: 1sqx C:261-379 [119039]
   Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxf_, d1sqxg_, d1sqxh_, d1sqxi_, d1sqxj_, d1sqxk_
   automated match to d1ntmc1
   complexed with fes, hem, sma, uq2

Details for d1sqxc1

PDB Entry: 1sqx, 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1sqxc1:

Sequence; same for both SEQRES and ATOM records:

>d1sqxc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

Timeline for d1sqxc1:

• d1sqxc1 first appeared in SCOP 1.73
  
• d1sqxc1 appears in SCOPe 2.06
  
• d1sqxc1 appears in the current release, SCOPe 2.08