SCOPe 2.05: Domain d1sqwa2: 1sqw A:1-94

Lineage for d1sqwa2 (1sqw A:1-94)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.6: Pre-PUA domain [88802] (5 families)
   this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins

5. Family d.17.6.3: Nip7p homolog, N-terminal domain [110832] (1 protein)

6. Protein Nip7p homolog, N-terminal domain [110833] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110834] (2 PDB entries)
   Uniprot Q9Y221

8. Domain d1sqwa2: 1sqw A:1-94 [119034]
   Other proteins in same PDB: d1sqwa1
   automated match to d1sqwa2

Details for d1sqwa2

PDB Entry: 1sqw, 1.9 Å

PDB Description: Crystal structure of KD93, a novel protein expressed in the human pro

PDB Compounds: (A:) Saccharomyces cerevisiae Nip7p homolog

SCOPe Domain Sequences for d1sqwa2:

Sequence; same for both SEQRES and ATOM records:

>d1sqwa2 d.17.6.3 (A:1-94) Nip7p homolog, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mrplteeetrvmfekiakyigenlqllvdrpdgtycfrlhndrvyyvsekimklaanisg
dklvslgtcfgkftkthkfrlhvtaldylapyak

Timeline for d1sqwa2:

• d1sqwa2 first appeared in SCOP 1.73
  
• d1sqwa2 appears in SCOPe 2.04
  
• d1sqwa2 appears in SCOPe 2.06
  
• d1sqwa2 appears in the current release, SCOPe 2.08