Lineage for d1sqwa2 (1sqw A:1-94)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2937437Superfamily d.17.6: Pre-PUA domain [88802] (5 families) (S)
    this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins
  5. 2937453Family d.17.6.3: Nip7p homolog, N-terminal domain [110832] (1 protein)
  6. 2937454Protein Nip7p homolog, N-terminal domain [110833] (1 species)
  7. 2937455Species Human (Homo sapiens) [TaxId:9606] [110834] (2 PDB entries)
    Uniprot Q9Y221
  8. 2937456Domain d1sqwa2: 1sqw A:1-94 [119034]
    Other proteins in same PDB: d1sqwa1
    automated match to d1sqwa2

Details for d1sqwa2

PDB Entry: 1sqw (more details), 1.9 Å

PDB Description: Crystal structure of KD93, a novel protein expressed in the human pro
PDB Compounds: (A:) Saccharomyces cerevisiae Nip7p homolog

SCOPe Domain Sequences for d1sqwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqwa2 d.17.6.3 (A:1-94) Nip7p homolog, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mrplteeetrvmfekiakyigenlqllvdrpdgtycfrlhndrvyyvsekimklaanisg
dklvslgtcfgkftkthkfrlhvtaldylapyak

SCOPe Domain Coordinates for d1sqwa2:

Click to download the PDB-style file with coordinates for d1sqwa2.
(The format of our PDB-style files is described here.)

Timeline for d1sqwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sqwa1