Lineage for d1sqwa1 (1sqw A:95-176)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2823866Family b.122.1.1: PUA domain [88698] (6 proteins)
    RNA-binding domain
  6. 2823885Protein Nip7p homolog, C-terminal domain [110337] (1 species)
  7. 2823886Species Human (Homo sapiens) [TaxId:9606] [110338] (2 PDB entries)
    Uniprot Q9Y221
  8. 2823887Domain d1sqwa1: 1sqw A:95-176 [119033]
    Other proteins in same PDB: d1sqwa2
    automated match to d1sqwa1

Details for d1sqwa1

PDB Entry: 1sqw (more details), 1.9 Å

PDB Description: Crystal structure of KD93, a novel protein expressed in the human pro
PDB Compounds: (A:) Saccharomyces cerevisiae Nip7p homolog

SCOPe Domain Sequences for d1sqwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqwa1 b.122.1.1 (A:95-176) Nip7p homolog, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ykvwikpgaeqsflygnhvlksglgritentsqyqgvvvysmadiplgfgvaakstqdcr
kvdpmaivvfhqadigeyvrhe

SCOPe Domain Coordinates for d1sqwa1:

Click to download the PDB-style file with coordinates for d1sqwa1.
(The format of our PDB-style files is described here.)

Timeline for d1sqwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sqwa2