SCOPe 2.08: Domain d1sqwa1: 1sqw A:95-176

Lineage for d1sqwa1 (1sqw A:95-176)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.1: PUA domain [88698] (6 proteins)
   RNA-binding domain

6. Protein Nip7p homolog, C-terminal domain [110337] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110338] (2 PDB entries)
   Uniprot Q9Y221

8. Domain d1sqwa1: 1sqw A:95-176 [119033]
   Other proteins in same PDB: d1sqwa2
   automated match to d1sqwa1

Details for d1sqwa1

PDB Entry: 1sqw, 1.9 Å

PDB Description: Crystal structure of KD93, a novel protein expressed in the human pro

PDB Compounds: (A:) Saccharomyces cerevisiae Nip7p homolog

SCOPe Domain Sequences for d1sqwa1:

Sequence; same for both SEQRES and ATOM records:

>d1sqwa1 b.122.1.1 (A:95-176) Nip7p homolog, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ykvwikpgaeqsflygnhvlksglgritentsqyqgvvvysmadiplgfgvaakstqdcr
kvdpmaivvfhqadigeyvrhe

Timeline for d1sqwa1:

• d1sqwa1 first appeared in SCOP 1.73
  
• d1sqwa1 appears in SCOPe 2.07