Class b: All beta proteins [48724] (180 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (15 families) |
Family b.122.1.1: PUA domain [88698] (6 proteins) RNA-binding domain |
Protein Nip7p homolog, C-terminal domain [110337] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110338] (2 PDB entries) Uniprot Q9Y221 |
Domain d1sqwa1: 1sqw A:95-176 [119033] Other proteins in same PDB: d1sqwa2 automated match to d1sqwa1 |
PDB Entry: 1sqw (more details), 1.9 Å
SCOPe Domain Sequences for d1sqwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqwa1 b.122.1.1 (A:95-176) Nip7p homolog, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ykvwikpgaeqsflygnhvlksglgritentsqyqgvvvysmadiplgfgvaakstqdcr kvdpmaivvfhqadigeyvrhe
Timeline for d1sqwa1: