Lineage for d1sqvj_ (1sqv J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631382Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 2631383Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 2631384Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 2631395Species Cow (Bos taurus) [TaxId:9913] [81509] (20 PDB entries)
    Uniprot P00130
  8. 2631409Domain d1sqvj_: 1sqv J: [119032]
    Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqve1, d1sqve2, d1sqvf_, d1sqvg_, d1sqvh_, d1sqvi_, d1sqvk_
    automated match to d1be3j_
    complexed with fes, hem, uhd, uq2

Details for d1sqvj_

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt
PDB Compounds: (J:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOPe Domain Sequences for d1sqvj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqvj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
n

SCOPe Domain Coordinates for d1sqvj_:

Click to download the PDB-style file with coordinates for d1sqvj_.
(The format of our PDB-style files is described here.)

Timeline for d1sqvj_: