Lineage for d1sqvi_ (1sqv I:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611009Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 2611010Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 2611025Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 2611026Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 2611027Species Cow (Bos taurus) [TaxId:9913] [90079] (15 PDB entries)
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
    Uniprot P13272 1-57 ! Uniprot P13272
  8. 2611041Domain d1sqvi_: 1sqv I: [119031]
    Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqve1, d1sqve2, d1sqvf_, d1sqvg_, d1sqvh_, d1sqvj_, d1sqvk_
    automated match to d1l0li_
    complexed with fes, hem, uhd, uq2

Details for d1sqvi_

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt
PDB Compounds: (I:) Ubiquinol-cytochrome C reductase complex 8 kDa protein

SCOPe Domain Sequences for d1sqvi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqvi_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

SCOPe Domain Coordinates for d1sqvi_:

Click to download the PDB-style file with coordinates for d1sqvi_.
(The format of our PDB-style files is described here.)

Timeline for d1sqvi_: