Lineage for d1sqvf1 (1sqv F:6-110)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060623Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1060624Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
  5. 1060625Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1060626Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 1060637Species Cow (Bos taurus) [TaxId:9913] [81519] (18 PDB entries)
    Uniprot P00129
  8. 1060652Domain d1sqvf1: 1sqv F:6-110 [119028]
    Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqvg_, d1sqvh_, d1sqvi1, d1sqvj_, d1sqvk_
    automatically matched to d1l0lf_
    complexed with fes, hem, uhd, uq2

Details for d1sqvf1

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with UHDBT
PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOPe Domain Sequences for d1sqvf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqvf1 f.27.1.1 (F:6-110) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

SCOPe Domain Coordinates for d1sqvf1:

Click to download the PDB-style file with coordinates for d1sqvf1.
(The format of our PDB-style files is described here.)

Timeline for d1sqvf1: