| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) ![]() |
| Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
| Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [81643] (18 PDB entries) Uniprot P00157 |
| Domain d1sqvc1: 1sqv C:261-379 [119024] Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc2, d1sqvd1, d1sqvd2, d1sqve1, d1sqve2, d1sqvf_, d1sqvg_, d1sqvh_, d1sqvi_, d1sqvj_, d1sqvk_ automated match to d1ntmc1 complexed with fes, hem, uhd, uq2 |
PDB Entry: 1sqv (more details), 2.85 Å
SCOPe Domain Sequences for d1sqvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqvc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw
Timeline for d1sqvc1: