Lineage for d1sqvb2 (1sqv B:236-439)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1228134Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1228135Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1228136Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1228211Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 1228240Species Cow (Bos taurus) [TaxId:9913] [56000] (18 PDB entries)
    Uniprot P23004
  8. 1228270Domain d1sqvb2: 1sqv B:236-439 [119023]
    Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqvf_, d1sqvg_, d1sqvh_, d1sqvi1, d1sqvj_, d1sqvk_
    automatically matched to d1bccb2
    complexed with fes, hem, uhd, uq2

Details for d1sqvb2

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt
PDB Compounds: (B:) Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial

SCOPe Domain Sequences for d1sqvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqvb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

SCOPe Domain Coordinates for d1sqvb2:

Click to download the PDB-style file with coordinates for d1sqvb2.
(The format of our PDB-style files is described here.)

Timeline for d1sqvb2: