Lineage for d1sqqj1 (1sqq J:3-61)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887564Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
  5. 887565Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)
  6. 887566Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 887582Species Cow (Bos taurus) [TaxId:9913] [81509] (18 PDB entries)
    Uniprot P00130
  8. 887598Domain d1sqqj1: 1sqq J:3-61 [119019]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqi1, d1sqqk1
    automatically matched to d1be3j_
    complexed with fes, hem, ost, uq2

Details for d1sqqj1

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
PDB Compounds: (J:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOP Domain Sequences for d1sqqj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqj1 f.23.14.1 (J:3-61) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
ptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkyen

SCOP Domain Coordinates for d1sqqj1:

Click to download the PDB-style file with coordinates for d1sqqj1.
(The format of our PDB-style files is described here.)

Timeline for d1sqqj1: