SCOPe 2.08: Domain d1sqqj_: 1sqq J:

Lineage for d1sqqj_ (1sqq J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)
   automatically mapped to Pfam PF05365

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)

6. Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
   interacts with cytochrome c1 and ISP

7. Species Cow (Bos taurus) [TaxId:9913] [81509] (20 PDB entries)
   Uniprot P00130

8. Domain d1sqqj_: 1sqq J: [119019]
   Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqk1
   automated match to d2a06w_
   complexed with fes, hec, ost, uq2

Details for d1sqqj_

PDB Entry: 1sqq, 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)

PDB Compounds: (J:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOPe Domain Sequences for d1sqqj_:

Sequence; same for both SEQRES and ATOM records:

>d1sqqj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
ptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkyen

Timeline for d1sqqj_:

• d1sqqj_ first appeared in SCOP 1.73, called d1sqqj1
  
• d1sqqj_ appears in SCOPe 2.07