Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) not a true superfamily |
Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins) beta-hairpin and a short alpha-helix bound to the core subunits |
Protein automated matches [254424] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [254879] (3 PDB entries) |
Domain d1sqqi_: 1sqq I: [119018] Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqj_, d1sqqk1 automated match to d2fyui_ complexed with fes, hem, ost, uq2 |
PDB Entry: 1sqq (more details), 3 Å
SCOPe Domain Sequences for d1sqqi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqqi_ d.184.1.3 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]} mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg
Timeline for d1sqqi_: