SCOPe 2.03: Domain d1sqqi1: 1sqq I:1-57

Lineage for d1sqqi1 (1sqq I:1-57)

Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
not a true fold
Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families)
not a true superfamily
Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein)
beta-hairpin and a short alpha-helix bound to the core subunits
Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)

Species Cow (Bos taurus) [TaxId:9913] [90079] (15 PDB entries)
there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
Uniprot P13272 1-57 ! Uniprot P13272

Domain d1sqqi1: 1sqq I:1-57 [119018]
Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqj1, d1sqqk1
automatically matched to d1l0li_
complexed with fes, hem, ost, uq2

Details for d1sqqi1

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)

PDB Compounds: (I:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOPe Domain Sequences for d1sqqi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqi1 d.184.1.3 (I:1-57) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

SCOPe Domain Coordinates for d1sqqi1:

Click to download the PDB-style file with coordinates for d1sqqi1.
(The format of our PDB-style files is described here.)

Timeline for d1sqqi1: