Lineage for d1sqqi_ (1sqq I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005102Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3005103Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 3005124Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 3005145Protein automated matches [254424] (1 species)
    not a true protein
  7. 3005146Species Cow (Bos taurus) [TaxId:9913] [254879] (3 PDB entries)
  8. 3005147Domain d1sqqi_: 1sqq I: [119018]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqj_, d1sqqk1
    automated match to d2fyui_
    complexed with fes, hec, ost, uq2

Details for d1sqqi_

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
PDB Compounds: (I:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOPe Domain Sequences for d1sqqi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqi_ d.184.1.3 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

SCOPe Domain Coordinates for d1sqqi_:

Click to download the PDB-style file with coordinates for d1sqqi_.
(The format of our PDB-style files is described here.)

Timeline for d1sqqi_: