SCOPe 2.06: Domain d1sqqd2: 1sqq D:196-241

Lineage for d1sqqd2 (1sqq D:196-241)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.0: automated matches [232790] (1 protein)
   not a true family

6. Protein automated matches [232791] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [254894] (1 PDB entry)

8. Domain d1sqqd2: 1sqq D:196-241 [119014]
   Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1
   automated match to d2a06d2
   complexed with fes, hem, ost, uq2

Details for d1sqqd2

PDB Entry: 1sqq, 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d1sqqd2:

Sequence; same for both SEQRES and ATOM records:

>d1sqqd2 f.23.11.0 (D:196-241) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

Timeline for d1sqqd2:

• d1sqqd2 first appeared in SCOP 1.73
  
• d1sqqd2 appears in SCOPe 2.05
  
• d1sqqd2 appears in SCOPe 2.07
  
• d1sqqd2 appears in the current release, SCOPe 2.08