Lineage for d1sqqd2 (1sqq D:196-241)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958008Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) (S)
  5. 1958048Family f.23.11.0: automated matches [232790] (1 protein)
    not a true family
  6. 1958049Protein automated matches [232791] (3 species)
    not a true protein
  7. Species Cow (Bos taurus) [TaxId:9913] [254894] (1 PDB entry)
  8. 1958069Domain d1sqqd2: 1sqq D:196-241 [119014]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1
    automated match to d2a06d2
    complexed with fes, hem, ost, uq2

Details for d1sqqd2

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d1sqqd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqd2 f.23.11.0 (D:196-241) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

SCOPe Domain Coordinates for d1sqqd2:

Click to download the PDB-style file with coordinates for d1sqqd2.
(The format of our PDB-style files is described here.)

Timeline for d1sqqd2: