![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) ![]() |
![]() | Family f.23.11.0: automated matches [232790] (1 protein) not a true family |
![]() | Protein automated matches [232791] (3 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [254894] (2 PDB entries) |
![]() | Domain d1sqqd2: 1sqq D:196-241 [119014] Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1 automated match to d2a06d2 complexed with fes, hec, ost, uq2 |
PDB Entry: 1sqq (more details), 3 Å
SCOPe Domain Sequences for d1sqqd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqqd2 f.23.11.0 (D:196-241) automated matches {Cow (Bos taurus) [TaxId: 9913]} pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk
Timeline for d1sqqd2: