SCOPe 2.08: Domain d1sqqd1: 1sqq D:1-195

Lineage for d1sqqd1 (1sqq D:1-195)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein automated matches [232767] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [254893] (2 PDB entries)

8. Domain d1sqqd1: 1sqq D:1-195 [119013]
   Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1
   automated match to d2a06d1
   complexed with fes, hec, ost, uq2

Details for d1sqqd1

PDB Entry: 1sqq, 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d1sqqd1:

Sequence; same for both SEQRES and ATOM records:

>d1sqqd1 a.3.1.3 (D:1-195) automated matches {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

Timeline for d1sqqd1:

• d1sqqd1 first appeared in SCOP 1.73
  
• d1sqqd1 appears in SCOPe 2.07