![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
![]() | Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein automated matches [196844] (6 species) not a true protein |
![]() | Domain d1sqqc2: 1sqq C:2-260 [119012] Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1 automated match to d1be3c3 complexed with fes, hem, ost, uq2 |
PDB Entry: 1sqq (more details), 3 Å
SCOPe Domain Sequences for d1sqqc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqqc2 f.21.1.2 (C:2-260) automated matches {Cow (Bos taurus) [TaxId: 9913]} tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml lvlfapdllgdpdnytpan
Timeline for d1sqqc2: