| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) ![]() |
| Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
| Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [81643] (18 PDB entries) Uniprot P00157 |
| Domain d1sqqc1: 1sqq C:261-379 [119011] Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqi1, d1sqqj1, d1sqqk1 automatically matched to d1be3c2 complexed with fes, hem, ost, uq2 |
PDB Entry: 1sqq (more details), 3 Å
SCOPe Domain Sequences for d1sqqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqqc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw
Timeline for d1sqqc1: