SCOPe 2.02: Domain d1sqqb2: 1sqq B:236-439

Lineage for d1sqqb2 (1sqq B:236-439)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56000] (18 PDB entries)
   Uniprot P23004

8. Domain d1sqqb2: 1sqq B:236-439 [119010]
   Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqi1, d1sqqj1, d1sqqk1
   automatically matched to d1bccb2
   complexed with fes, hem, ost, uq2

Details for d1sqqb2

PDB Entry: 1sqq, 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)

PDB Compounds: (B:) Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial precursor

SCOPe Domain Sequences for d1sqqb2:

Sequence; same for both SEQRES and ATOM records:

>d1sqqb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

Timeline for d1sqqb2:

• d1sqqb2 first appeared in SCOP 1.73
  
• d1sqqb2 appears in SCOPe 2.01
  
• d1sqqb2 appears in SCOPe 2.03
  
• d1sqqb2 appears in the current release, SCOPe 2.08