Lineage for d1sqqb2 (1sqq B:236-439)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005156Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 3005157Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 3005465Family d.185.1.0: automated matches [232765] (1 protein)
    not a true family
  6. 3005466Protein automated matches [232766] (2 species)
    not a true protein
  7. 3005531Species Cow (Bos taurus) [TaxId:9913] [254892] (2 PDB entries)
  8. 3005532Domain d1sqqb2: 1sqq B:236-439 [119010]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1
    automated match to d2bccb2
    complexed with fes, hec, ost, uq2

Details for d1sqqb2

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
PDB Compounds: (B:) Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial precursor

SCOPe Domain Sequences for d1sqqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqb2 d.185.1.0 (B:236-439) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

SCOPe Domain Coordinates for d1sqqb2:

Click to download the PDB-style file with coordinates for d1sqqb2.
(The format of our PDB-style files is described here.)

Timeline for d1sqqb2: