Lineage for d1sqpi1 (1sqp I:1-57)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049810Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 1049811Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) (S)
    not a true superfamily
  5. 1049826Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 1049827Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 1049828Species Cow (Bos taurus) [TaxId:9913] [90079] (14 PDB entries)
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
    Uniprot P13272 1-57 ! Uniprot P13272
  8. 1049842Domain d1sqpi1: 1sqp I:1-57 [119005]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpf1, d1sqpg_, d1sqph_, d1sqpj_, d1sqpk1
    automatically matched to d1l0li_
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpi1

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Myxothiazol
PDB Compounds: (I:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOPe Domain Sequences for d1sqpi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpi1 d.184.1.3 (I:1-57) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

SCOPe Domain Coordinates for d1sqpi1:

Click to download the PDB-style file with coordinates for d1sqpi1.
(The format of our PDB-style files is described here.)

Timeline for d1sqpi1: