Lineage for d1sqph1 (1sqp H:12-78)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746390Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 746391Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
  5. 746392Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 746393Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 746405Species Cow (Bos taurus) [TaxId:9913] [81526] (18 PDB entries)
  8. 746421Domain d1sqph1: 1sqp H:12-78 [119004]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpg1, d1sqpi1, d1sqpj1
    automatically matched to d1l0lh_
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqph1

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Myxothiazol
PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOP Domain Sequences for d1sqph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqph1 f.28.1.1 (H:12-78) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
klfnslk

SCOP Domain Coordinates for d1sqph1:

Click to download the PDB-style file with coordinates for d1sqph1.
(The format of our PDB-style files is described here.)

Timeline for d1sqph1: