Lineage for d1sqpg_ (1sqp G:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254451Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 2254452Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 2254453Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 2254470Species Cow (Bos taurus) [TaxId:9913] [81503] (19 PDB entries)
    Uniprot P13271 #SP ! Uniprot P13271
  8. 2254489Domain d1sqpg_: 1sqp G: [119003]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpe1, d1sqpe2, d1sqpf1, d1sqph_, d1sqpi_, d1sqpj_, d1sqpk1
    automated match to d1be3g_
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpg_

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol
PDB Compounds: (G:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d1sqpg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

SCOPe Domain Coordinates for d1sqpg_:

Click to download the PDB-style file with coordinates for d1sqpg_.
(The format of our PDB-style files is described here.)

Timeline for d1sqpg_: