Lineage for d1sqpd1 (1sqp D:1-195)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1720126Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 1720127Protein Cytochrome bc1 domain [46677] (3 species)
  7. 1720143Species Cow (Bos taurus) [TaxId:9913] [46678] (17 PDB entries)
    Uniprot P00125
  8. 1720160Domain d1sqpd1: 1sqp D:1-195 [119001]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd2, d1sqpe1, d1sqpe2, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi_, d1sqpj_, d1sqpk1
    automated match to d1ppjd1
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpd1

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d1sqpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOPe Domain Coordinates for d1sqpd1:

Click to download the PDB-style file with coordinates for d1sqpd1.
(The format of our PDB-style files is described here.)

Timeline for d1sqpd1: