![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein) |
![]() | Protein Cytochrome bc1 domain [46677] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries) |
![]() | Domain d1sqpd1: 1sqp D:1-195 [119001] Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd2, d1sqpg1, d1sqph1, d1sqpi1, d1sqpj1 automatically matched to d1be3d2 complexed with cdl, fes, hem, myx, pee, plx |
PDB Entry: 1sqp (more details), 2.7 Å
SCOP Domain Sequences for d1sqpd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqpd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]} sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms qvakdvctflrwaae
Timeline for d1sqpd1: