Lineage for d1sqpc1 (1sqp C:261-379)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746449Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 746450Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 746451Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 746452Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 746464Species Cow (Bos taurus) [TaxId:9913] [81643] (17 PDB entries)
  8. 746478Domain d1sqpc1: 1sqp C:261-379 [118999]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpg1, d1sqph1, d1sqpi1, d1sqpj1
    automatically matched to d1be3c2
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpc1

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol
PDB Compounds: (C:) cytochrome b

SCOP Domain Sequences for d1sqpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOP Domain Coordinates for d1sqpc1:

Click to download the PDB-style file with coordinates for d1sqpc1.
(The format of our PDB-style files is described here.)

Timeline for d1sqpc1: