Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:224325] [186763] (1 PDB entry) |
Domain d1sq3k_: 1sq3 K: [118993] automated match to d1vlga_ complexed with fe |
PDB Entry: 1sq3 (more details), 2.7 Å
SCOPe Domain Sequences for d1sq3k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sq3k_ a.25.1.0 (K:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]} sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
Timeline for d1sq3k_: