Lineage for d1sq3j1 (1sq3 J:3-164)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 639040Protein Non-hem ferritin [63524] (4 species)
  7. 639041Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [140432] (2 PDB entries)
  8. 639063Domain d1sq3j1: 1sq3 J:3-164 [118992]
    automatically matched to 1S3Q A:3-164
    complexed with fe

Details for d1sq3j1

PDB Entry: 1sq3 (more details), 2.7 Å

PDB Description: crystal structures of a novel open pore ferritin from the hyperthermophilic archaeon archaeoglobus fulgidus.
PDB Compounds: (J:) Ferritin

SCOP Domain Sequences for d1sq3j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sq3j1 a.25.1.1 (J:3-164) Non-hem ferritin {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
qwyvaeqveeeasaldiveklrligedkrallfldkelslrq

SCOP Domain Coordinates for d1sq3j1:

Click to download the PDB-style file with coordinates for d1sq3j1.
(The format of our PDB-style files is described here.)

Timeline for d1sq3j1: