Lineage for d1sq3j_ (1sq3 J:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. Protein automated matches [190036] (58 species)
    not a true protein
  7. Species Archaeoglobus fulgidus [TaxId:224325] [186763] (1 PDB entry)
  8. Domain d1sq3j_: 1sq3 J: [118992]
    automated match to d1vlga_
    complexed with fe

Details for d1sq3j_

PDB Entry: 1sq3 (more details), 2.7 Å

PDB Description: crystal structures of a novel open pore ferritin from the hyperthermophilic archaeon archaeoglobus fulgidus.
PDB Compounds: (J:) Ferritin

SCOPe Domain Sequences for d1sq3j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sq3j_ a.25.1.0 (J:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
qwyvaeqveeeasaldiveklrligedkrallfldkelslrq

SCOPe Domain Coordinates for d1sq3j_ are not available.

Timeline for d1sq3j_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sq3a_, d1sq3b_, d1sq3c_, d1sq3d_, d1sq3e_, d1sq3f_, d1sq3g_, d1sq3h_, d1sq3i_, d1sq3k_, d1sq3l_