Lineage for d1sq3d_ (1sq3 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2703959Species Archaeoglobus fulgidus [TaxId:224325] [186763] (1 PDB entry)
  8. 2703963Domain d1sq3d_: 1sq3 D: [118986]
    automated match to d1vlga_
    complexed with fe

Details for d1sq3d_

PDB Entry: 1sq3 (more details), 2.7 Å

PDB Description: crystal structures of a novel open pore ferritin from the hyperthermophilic archaeon archaeoglobus fulgidus.
PDB Compounds: (D:) Ferritin

SCOPe Domain Sequences for d1sq3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sq3d_ a.25.1.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
qwyvaeqveeeasaldiveklrligedkrallfldkelslrq

SCOPe Domain Coordinates for d1sq3d_:

Click to download the PDB-style file with coordinates for d1sq3d_.
(The format of our PDB-style files is described here.)

Timeline for d1sq3d_: