Lineage for d1sq3c_ (1sq3 C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1486323Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1486324Protein automated matches [190036] (29 species)
    not a true protein
  7. 1486337Species Archaeoglobus fulgidus [TaxId:224325] [186763] (1 PDB entry)
  8. 1486340Domain d1sq3c_: 1sq3 C: [118985]
    automated match to d1vlga_
    complexed with fe

Details for d1sq3c_

PDB Entry: 1sq3 (more details), 2.7 Å

PDB Description: crystal structures of a novel open pore ferritin from the hyperthermophilic archaeon archaeoglobus fulgidus.
PDB Compounds: (C:) Ferritin

SCOPe Domain Sequences for d1sq3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sq3c_ a.25.1.0 (C:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
qwyvaeqveeeasaldiveklrligedkrallfldkelslrq

SCOPe Domain Coordinates for d1sq3c_:

Click to download the PDB-style file with coordinates for d1sq3c_.
(The format of our PDB-style files is described here.)

Timeline for d1sq3c_: