Lineage for d1sq3a_ (1sq3 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1085586Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1085587Protein automated matches [190036] (15 species)
    not a true protein
  7. 1085600Species Archaeoglobus fulgidus [TaxId:224325] [186763] (1 PDB entry)
  8. 1085601Domain d1sq3a_: 1sq3 A: [118983]
    automated match to d1vlga_
    complexed with fe

Details for d1sq3a_

PDB Entry: 1sq3 (more details), 2.7 Å

PDB Description: crystal structures of a novel open pore ferritin from the hyperthermophilic archaeon archaeoglobus fulgidus.
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d1sq3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sq3a_ a.25.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
qwyvaeqveeeasaldiveklrligedkrallfldkelslrq

SCOPe Domain Coordinates for d1sq3a_:

Click to download the PDB-style file with coordinates for d1sq3a_.
(The format of our PDB-style files is described here.)

Timeline for d1sq3a_: