| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (9 proteins) |
| Protein Bacterioferritin (cytochrome b1) [47244] (4 species) binds heme between two subunits; 24-mer |
| Species Azotobacter vinelandii [TaxId:354] [140431] (3 PDB entries) |
| Domain d1sofe1: 1sof E:1-154 [118977] automatically matched to 1SOF A:1-154 complexed with ba, fe2, hem, mg |
PDB Entry: 1sof (more details), 2.6 Å
SCOP Domain Sequences for d1sofe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sofe1 a.25.1.1 (E:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]}
mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
edileseedhidwletqldlidkiglenylqsqm
Timeline for d1sofe1: