Lineage for d1sofd_ (1sof D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2315428Species Azotobacter vinelandii [TaxId:354] [186762] (3 PDB entries)
  8. 2315439Domain d1sofd_: 1sof D: [118976]
    Other proteins in same PDB: d1sofa1
    automated match to d1bcfa_
    complexed with ba, fe2, hem, mg

Details for d1sofd_

PDB Entry: 1sof (more details), 2.6 Å

PDB Description: Crystal structure of the azotobacter vinelandii bacterioferritin at 2.6 A resolution
PDB Compounds: (D:) bacterioferritin

SCOPe Domain Sequences for d1sofd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sofd_ a.25.1.1 (D:) automated matches {Azotobacter vinelandii [TaxId: 354]}
mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
edileseedhidwletqldlidkiglenylqsqmd

SCOPe Domain Coordinates for d1sofd_:

Click to download the PDB-style file with coordinates for d1sofd_.
(The format of our PDB-style files is described here.)

Timeline for d1sofd_: